PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G12640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 304aa    MW: 32218.1 Da    PI: 6.2287
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G12640.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.4e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.kgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l+ +   +G+g+W++++++ g ++R++k+c++r+ +yl
  OMERI03G12640.1 14 KGPWTAEEDAKLLAYTSTHGTGNWTSVPQRAGrLKRCGKSCRLRYTNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding53.65.3e-1770111346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T+eE+el+v ++++lG++ W++Ia+ ++ gRt++++k++w++
  OMERI03G12640.1  70 NFTQEEEELIVTLHAMLGSR-WSLIANQLP-GRTDNDVKNYWNT 111
                      89******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.8E-23566IPR009057Homeodomain-like
PROSITE profilePS5129416.463962IPR017930Myb domain
SuperFamilySSF466895.14E-2911109IPR009057Homeodomain-like
SMARTSM007175.4E-141364IPR001005SANT/Myb domain
PfamPF002492.4E-151462IPR001005SANT/Myb domain
CDDcd001675.30E-111662No hitNo description
PROSITE profilePS5129425.00363117IPR017930Myb domain
SMARTSM007173.5E-1567115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2367117IPR009057Homeodomain-like
PfamPF002493.4E-1570111IPR001005SANT/Myb domain
CDDcd001671.28E-1270113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MGRPPCCDKA NVKKGPWTAE EDAKLLAYTS THGTGNWTSV PQRAGRLKRC GKSCRLRYTN  60
YLRPNLKHEN FTQEEEELIV TLHAMLGSRW SLIANQLPGR TDNDVKNYWN TKLSKKLRQR  120
GIDPITHRPI ADLMQSIGTL AIRPPPAAGA APPPCLPVFH GAPYFAALQH QQQQVVTHVD  180
ADAPASPDSQ HLQLNWSDFL ADDAAGHGAD APAPQAALAQ YQEGSAPAAT TVVGGGRAFG  240
DVDGASGVGA GTYDGAGAAS AFIDAILDCD KEMAVDQLIA EMLADPAYYG GGGGSSSSEL  300
GWGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1186700.0AC118670.2 Genomic sequence for Oryza sativa, Nipponbare stain, clone OSJNBb0036D03, from chromosome 3, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630216.10.0PREDICTED: transcription factor MYB35
SwissprotQ9XHV09e-65MYB80_ARATH; Transcription factor MYB80
TrEMBLA0A0E0CZ730.0A0A0E0CZ73_9ORYZ; Uncharacterized protein
STRINGLOC_Os03g18480.10.0(Oryza sativa Japonica Group)
STRINGORGLA03G0133600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118743439
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.12e-64myb domain protein 103